Recombinant Human TEX33 Protein

Recombinant Human TEX33 Protein
SKU
ASBPP-4323-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43247

Gene Name: CIMIP4

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Met1

End Site: Tyr280

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MELGHGAGTTTFTRAHLNDKEGQQDLDPWKAAYSSLDTSKFKNQGLSSPQPLPLGASAQGSSLGQCHLKEIPPPPPTAASRDSLGMDPQSRSLKNAGSRSSSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLFRGAAEETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHQKNAMNLNLQKALEEKYGENSKSKSSKY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Pig - 69%, Cynomolgus monkey - 91%

Alternative gene names: C22orf33; EAN57; TEX33

Alternative protein names: Ciliary microtubule inner protein 4; Testis-expressed protein 33

Protein name: ciliary microtubule inner protein 4

Full length: 280 amino acids

Entry name: CMIP4_HUMAN
More Information
SKU ASBPP-4323-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4323-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 339669
Product information (PDF)
×
MSDS (PDF)
×