Recombinant Human THEMIS Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N1K5

Gene Name: THEMIS

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Leu531

End Site: Gln640

Coverage: 0.17

Isoelectric Point: 7.5

Core Sequence: LVEEITEEQYYMMRRYESSASHPPPRPPKHPSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKNEKHQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 79%, Cynomolgus monkey - 96%

Alternative gene names: C6orf190; C6orf207

Alternative protein names: Protein THEMIS; Thymocyte-expressed molecule involved in selection

Protein name: thymocyte selection associated

Full length: 641 amino acids

Entry name: THMS1_HUMAN

• SKU: ASBPP-4288-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4288-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 387357