Recombinant Human THSD7A Protein

Recombinant Human THSD7A Protein
SKU
ASBPP-432-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPZ6

Gene Name: THSD7A

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Pro1511

End Site: Gly1590

Coverage: 0.05

Isoelectric Point: 6.5

Core Sequence: PDADRSCNPPCSQPHSYCSETKTCHCEEGYTEVMSSNSTLEQCTLIPVVVLPTMEDKRGDVKTSRAVHPTQPSSNPAGRG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0960

Alternative protein names: Thrombospondin type-1 domain-containing protein 7A [Cleaved into: Thrombospondin type-1 domain-containing protein 7A; soluble form]

Protein name: thrombospondin type 1 domain containing 7A

Full length: 1657 amino acids

Entry name: THS7A_HUMAN

Product panel: Autoimmune Disease
More Information
SKU ASBPP-432-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-432-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 221981
Product information (PDF)
×
MSDS (PDF)
×