Recombinant Human CD90 Protein

Recombinant Human CD90 Protein
SKU
ASBPP-3014-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P04216

Gene Name: THY1

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Gln20

End Site: Ser141

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 67%, Pig - 80%

Alternative gene names: /

Alternative protein names: Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; CD antigen CD90

Protein name: Thy-1 cell surface antigen

Full length: 161 amino acids

Entry name: THY1_HUMAN

CD Antigen: CD90

Product panel: Neuroscience Biomarkers,CD Antigen
More Information
SKU ASBPP-3014-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3014-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7070
Product information (PDF)
×
MSDS (PDF)
×