Recombinant Human TIRAP Protein

Recombinant Human TIRAP Protein
SKU
ASBPP-4018-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P58753

Gene Name: TIRAP

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Gly11

End Site: Ser80

Coverage: 0.37

Isoelectric Point: 11

Core Sequence: GSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Pig - 64%, Cynomolgus monkey - 92%

Alternative gene names: MAL

Alternative protein names: Toll/interleukin-1 receptor domain-containing adapter protein; TIR domain-containing adapter protein; Adaptor protein Wyatt; MyD88 adapter-like protein; MyD88-2

Protein name: TIR domain containing adaptor protein

Full length: 221 amino acids

Entry name: TIRAP_HUMAN
More Information
SKU ASBPP-4018-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4018-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 114609
Product information (PDF)
×
MSDS (PDF)
×