Recombinant Human TNNI3K Protein

Recombinant Human TNNI3K Protein
SKU
ASBPP-4211-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q59H18

Gene Name: TNNI3K

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Thr11

End Site: Ala230

Coverage: 0.27

Isoelectric Point: 7

Core Sequence: TCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHLCCICGGKKSHIRTLMLKGLRPSRLTRNGFTALHLAVYKDNAELITSLLHSGADIQQVGYGGLTALHIATIAGHLEAADVLLQHGANVNIQDAVFFTPLHIAAYYGHEQVTRLLLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 88%, Pig - 96%, Cynomolgus monkey - 98%

Alternative gene names: CARK

Alternative protein names: Serine/threonine-protein kinase TNNI3K; Cardiac ankyrin repeat kinase; Cardiac troponin I-interacting kinase; TNNI3-interacting kinase

Protein name: TNNI3 interacting kinase

Full length: 835 amino acids

Entry name: TNI3K_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4211-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4211-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51086
Product information (PDF)
×
MSDS (PDF)
×