Note: Dry Ice fees will be extra-charged
Uniprot: P13805
Gene Name: TNNT1
Expression System: Escherichia coli
Molecular Weight: 26 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 95%
Start Site: Glu11
End Site: Glu200
Coverage: 0.74
Isoelectric Point: 5
Core Sequence: EEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGE
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 97%
Alternative gene names: TNT
Alternative protein names: Troponin T; slow skeletal muscle; TnTs; Slow skeletal muscle troponin T; sTnT
Protein name: troponin T1, slow skeletal type
Full length: 278 amino acids
Entry name: TNNT1_HUMAN
English
Deutsch
