Recombinant Human TOP1 Protein

Recombinant Human TOP1 Protein
SKU
ASBPP-4377-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P11387

Gene Name: TOP1

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Glu221

End Site: Ile420

Coverage: 0.28

Isoelectric Point: 10

Core Sequence: EHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: DNA topoisomerase 1; DNA topoisomerase I

Protein name: DNA topoisomerase I

Full length: 765 amino acids

Entry name: TOP1_HUMAN

Product panel: Autoimmune Disease,DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-4377-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4377-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7150
Product information (PDF)
×
MSDS (PDF)
×