Recombinant Human TPPP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94811

Gene Name: TPPP

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Met1

End Site: Lys219

Coverage: 1.00

Isoelectric Point: 10

Core Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 97%

Alternative gene names: TPPP1

Alternative protein names: Tubulin polymerization-promoting protein; TPPP; 25 kDa brain-specific protein; TPPP/p25; p24; p25-alpha

Protein name: tubulin polymerization promoting protein

Full length: 219 amino acids

Entry name: TPPP_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4143-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4143-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 11076