Recombinant Human TRA2A Protein

Recombinant Human TRA2A Protein
SKU
ASBPP-10377-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13595

Gene Name: TRA2A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Gly11

End Site: Arg80

Coverage: 0.29

Isoelectric Point: 12.5

Core Sequence: GRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHSHRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Transformer-2 protein homolog alpha; TRA-2 alpha; TRA2-alpha; Transformer-2 protein homolog A

Protein name: transformer 2 alpha homolog

Full length: 282 amino acids

Entry name: TRA2A_HUMAN
More Information
SKU ASBPP-10377-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10377-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 29896
Product information (PDF)
×
MSDS (PDF)
×