Recombinant Human UBE2E2 Protein

Recombinant Human UBE2E2 Protein
SKU
ASBPP-3639-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96LR5

Gene Name: UBE2E2

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ser11

End Site: Lys120

Coverage: 0.61

Isoelectric Point: 6.5

Core Sequence: SPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 60%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: UBCH8

Alternative protein names: Ubiquitin-conjugating enzyme E2 E2; E2 ubiquitin-conjugating enzyme E2; UbcH8; Ubiquitin carrier protein E2; Ubiquitin-protein ligase E2

Protein name: ubiquitin conjugating enzyme E2 E2

Full length: 201 amino acids

Entry name: UB2E2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3639-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3639-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7325
Product information (PDF)
×
MSDS (PDF)
×