Recombinant Human UBE2QL1 Protein

Recombinant Human UBE2QL1 Protein
SKU
ASBPP-3484-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A1L167

Gene Name: UBE2QL1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ser11

End Site: Tyr80

Coverage: 0.50

Isoelectric Point: 5

Core Sequence: SDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Ubiquitin-conjugating enzyme E2Q-like protein 1; E2Q-like ubiquitin-conjugating enzyme 1

Protein name: ubiquitin conjugating enzyme E2 QL1

Full length: 161 amino acids

Entry name: U2QL1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3484-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3484-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 134111
Product information (PDF)
×
MSDS (PDF)
×