Recombinant Human UBE2V1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13404

Gene Name: UBE2V1

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met1

End Site: Asn147

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 88%

Alternative gene names: CROC1; UBE2V; UEV1

Alternative protein names: Ubiquitin-conjugating enzyme E2 variant 1; UEV-1; CROC-1; TRAF6-regulated IKK activator 1 beta Uev1A

Protein name: ubiquitin conjugating enzyme E2 V1

Full length: 147 amino acids

Entry name: UB2V1_HUMAN

• SKU: ASBPP-3964-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3964-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7335