Recombinant Human UBXN7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94888

Gene Name: UBXN7

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asn171

End Site: Glu340

Coverage: 0.36

Isoelectric Point: 4.5

Core Sequence: NIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQETHFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0794; UBXD7

Alternative protein names: UBX domain-containing protein 7

Protein name: UBX domain protein 7

Full length: 489 amino acids

Entry name: UBXN7_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10490-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10490-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 26043