Recombinant Human VAMP7 Protein

Recombinant Human VAMP7 Protein
SKU
ASBPP-4017-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51809

Gene Name: VAMP7

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Gly11

End Site: Arg180

Coverage: 0.85

Isoelectric Point: 8.5

Core Sequence: GTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLAR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: SYBL1

Alternative protein names: Vesicle-associated membrane protein 7; VAMP-7; Synaptobrevin-like protein 1; Tetanus-insensitive VAMP; Ti-VAMP

Protein name: vesicle associated membrane protein 7

Full length: 220 amino acids

Entry name: VAMP7_HUMAN
More Information
SKU ASBPP-4017-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4017-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6845
Product information (PDF)
×
MSDS (PDF)
×