Recombinant Human WBP1L Protein

Recombinant Human WBP1L Protein
SKU
ASBPP-3643-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NX94

Gene Name: WBP1L

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Glu221

End Site: Gln330

Coverage: 0.34

Isoelectric Point: 4.5

Core Sequence: ELLKDDSSEHGAPDSKEKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQSSEEQAREPGHPHLPRPPACLLLNTINEQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 92%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: C10orf26; OPA1L

Alternative protein names: WW domain binding protein 1-like; Outcome predictor in acute leukemia 1

Protein name: WW domain binding protein 1 like

Full length: 342 amino acids

Entry name: WBP1L_HUMAN
More Information
SKU ASBPP-3643-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3643-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 54838
Product information (PDF)
×
MSDS (PDF)
×