Recombinant Human Wilms Tumor Protein Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P19544

Gene Name: WT1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ala131

End Site: Gln240

Coverage: 0.27

Isoelectric Point: 6.5

Core Sequence: APYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Wilms tumor protein; WT33

Protein name: WT1 transcription factor

Full length: 449 amino acids

Entry name: WT1_HUMAN

Product panel: IHC Pathology,DNA binding & Chromatin

• SKU: ASBPP-10499-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10499-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7490