Recombinant Human YAF2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IY57

Gene Name: YAF2

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Lys11

End Site: His180

Coverage: 0.99

Isoelectric Point: 10.5

Core Sequence: KRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: YY1-associated factor 2

Protein name: YY1 associated factor 2

Full length: 180 amino acids

Entry name: YAF2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10371-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10371-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10138