Recombinant Human ZBTB14 Protein

Recombinant Human ZBTB14 Protein
SKU
ASBPP-10409-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43829

Gene Name: ZBTB14

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Thr181

End Site: Thr300

Coverage: 0.29

Isoelectric Point: 5

Core Sequence: TPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: ZFP161; ZNF478

Alternative protein names: Zinc finger and BTB domain-containing protein 14; Zinc finger protein 161 homolog; Zfp-161; Zinc finger protein 478; Zinc finger protein 5 homolog; ZF5; Zfp-5; hZF5

Protein name: zinc finger and BTB domain containing 14

Full length: 449 amino acids

Entry name: ZBT14_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10409-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10409-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7541
Product information (PDF)
×
MSDS (PDF)
×