Recombinant Human ZBTB17 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13105

Gene Name: ZBTB17

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Gly651

End Site: Asp750

Coverage: 0.13

Isoelectric Point: 4.5

Core Sequence: GSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: MIZ1; ZNF151; ZNF60

Alternative protein names: Zinc finger and BTB domain-containing protein 17; Myc-interacting zinc finger protein 1; Miz-1; Zinc finger protein 151; Zinc finger protein 60

Protein name: zinc finger and BTB domain containing 17

Full length: 803 amino acids

Entry name: ZBT17_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-416-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-416-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7709