Recombinant Human ZBTB17 Protein

Recombinant Human ZBTB17 Protein
SKU
ASBPP-416-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13105

Gene Name: ZBTB17

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Gly651

End Site: Asp750

Coverage: 0.13

Isoelectric Point: 4.5

Core Sequence: GSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: MIZ1; ZNF151; ZNF60

Alternative protein names: Zinc finger and BTB domain-containing protein 17; Myc-interacting zinc finger protein 1; Miz-1; Zinc finger protein 151; Zinc finger protein 60

Protein name: zinc finger and BTB domain containing 17

Full length: 803 amino acids

Entry name: ZBT17_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-416-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-416-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7709
Product information (PDF)
×
MSDS (PDF)
×