Recombinant Human ZFP64 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NTW7

Gene Name: ZFP64

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Asp531

End Site: Val630

Coverage: 0.16

Isoelectric Point: 8.5

Core Sequence: DTKRPSSLAKHVDKVHRDEAKTENRAPLGKEGLREGSSQHVAKIVTQRAFRCETCGASFVRDDSLRCHKKQHSDQSENKNSDLVTFPPESGASGQLSTLV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Pig - 87%, Cynomolgus monkey - 97%

Alternative gene names: ZNF338

Alternative protein names: Zinc finger protein 64; Zfp-64; Zinc finger protein 338

Protein name: ZFP64 zinc finger protein

Full length: 645 amino acids

Entry name: ZF64B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10459-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10459-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55734