Recombinant Human ZHX2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6X8

Gene Name: ZHX2

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Gln21

End Site: Pro170

Coverage: 0.20

Isoelectric Point: 5.5

Core Sequence: QDVPEEVDRAKEKGIGTPQPDVAKDSWAAELENSSKENEVIEVKSMGESQSKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGEANFKLKLIKRNNQTVLEQSIETTNHVVSITTSGP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 85%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: AFR1; KIAA0854; RAF

Alternative protein names: Zinc fingers and homeoboxes protein 2; Alpha-fetoprotein regulator 1; AFP regulator 1; Regulator of AFP; Zinc finger and homeodomain protein 2

Protein name: zinc fingers and homeoboxes 2

Full length: 837 amino acids

Entry name: ZHX2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-1047-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1047-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 22882