Recombinant Human ZHX3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H4I2

Gene Name: ZHX3

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Phe611

End Site: Ser790

Coverage: 0.19

Isoelectric Point: 5

Core Sequence: FTPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLASELRVSGENGSLEMPSSHILAERKVSPIKINLKNLRVTEANGRNEIPGLGACDPEDDESNKLAEQLPGKVSCKKTAQQRHLLRQLFVQTQWPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 79%, Pig - 81%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0395; TIX1

Alternative protein names: Zinc fingers and homeoboxes protein 3; Triple homeobox protein 1; Zinc finger and homeodomain protein 3

Protein name: zinc fingers and homeoboxes 3

Full length: 956 amino acids

Entry name: ZHX3_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10435-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10435-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23051