Recombinant Human ZIK1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q3SY52

Gene Name: ZIK1

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Asp21

End Site: Asp150

Coverage: 0.28

Isoelectric Point: 6.5

Core Sequence: DLTKGCVTFEDIAIYFSQDEWGLLDEAQRLLYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 56%, Pig - 56%, Cynomolgus monkey - 97%

Alternative gene names: ZNF762

Alternative protein names: Zinc finger protein interacting with ribonucleoprotein K; Zinc finger protein 762

Protein name: zinc finger protein interacting with K protein 1

Full length: 487 amino acids

Entry name: ZIK1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3482-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3482-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 284307