Recombinant Human ZMAT5 Protein

Recombinant Human ZMAT5 Protein
SKU
ASBPP-3594-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UDW3

Gene Name: ZMAT5

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Phe41

End Site: Leu110

Coverage: 0.47

Isoelectric Point: 6

Core Sequence: FRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 94%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger matrin-type protein 5; U11/U12 small nuclear ribonucleoprotein 20 kDa protein; U11/U12 snRNP 20 kDa protein; U11/U12-20K

Protein name: zinc finger matrin-type 5

Full length: 170 amino acids

Entry name: ZMAT5_HUMAN
More Information
SKU ASBPP-3594-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3594-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55954
Product information (PDF)
×
MSDS (PDF)
×