Recombinant Human ZNF221 Protein

Recombinant Human ZNF221 Protein
SKU
ASBPP-3489-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UK13

Gene Name: ZNF221

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Cys371

End Site: His440

Coverage: 0.13

Isoelectric Point: 9

Core Sequence: CGKGFICRRDFCKHQMVHTGEKPYNCKECGKTFRWSSCLLNHQQVHSGQKSFKCEECGKGFYTNSRRSSH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 53%, Pig - 54%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 221

Protein name: zinc finger protein 221

Full length: 617 amino acids

Entry name: ZN221_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3489-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3489-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7638
Product information (PDF)
×
MSDS (PDF)
×