Recombinant Human ZNF320 Protein

Recombinant Human ZNF320 Protein
SKU
ASBPP-3434-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A2RRD8

Gene Name: ZNF320

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Glu91

End Site: Pro160

Coverage: 0.16

Isoelectric Point: 7

Core Sequence: EKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHTGEKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 47%, Pig - 38%, Cynomolgus monkey - 85%

Alternative gene names: /

Alternative protein names: Zinc finger protein 320

Protein name: zinc finger protein 320

Full length: 509 amino acids

Entry name: ZN320_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3434-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3434-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 162967
Product information (PDF)
×
MSDS (PDF)
×