Recombinant Human ZNF385B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q569K4

Gene Name: ZNF385B

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Asn131

End Site: Glu360

Coverage: 0.50

Isoelectric Point: 10

Core Sequence: NTMDPVQKAVINHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQPSSSESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEKAKKLLYCSLCKVAVNSLSQLEAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHCEICDVHVNSE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 60%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: ZNF533

Alternative protein names: Zinc finger protein 385B; Zinc finger protein 533

Protein name: zinc finger protein 385B

Full length: 471 amino acids

Entry name: Z385B_HUMAN

• SKU: ASBPP-10473-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10473-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 151126