Recombinant Human ZNF418 Protein

Recombinant Human ZNF418 Protein
SKU
ASBPP-3512-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TF45

Gene Name: ZNF418

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Val251

End Site: Cys350

Coverage: 0.17

Isoelectric Point: 8.5

Core Sequence: VHTGKRPYECGECGKSFSHKGSLVQHQRVHTGKRPYECGECGKSFSHKGSLVQHQRVHTGERPYECGECGKSFSQNGTLIKHQRVHTGERPYECEECGKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 62%, Pig - 71%, Cynomolgus monkey - 70%

Alternative gene names: KIAA1956

Alternative protein names: Zinc finger protein 418

Protein name: zinc finger protein 418

Full length: 676 amino acids

Entry name: ZN418_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3512-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3512-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 147686
Product information (PDF)
×
MSDS (PDF)
×