Recombinant Human ZNF451 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y4E5

Gene Name: ZNF451

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu21

End Site: Met140

Coverage: 0.11

Isoelectric Point: 5

Core Sequence: ESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSYTDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEFIRGHSDTEAARLCVDQWLKM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 93%, Cynomolgus monkey - 97%

Alternative gene names: COASTER; KIAA0576; KIAA1702

Alternative protein names: E3 SUMO-protein ligase ZNF451; Coactivator for steroid receptors; E3 SUMO-protein transferase ZNF451; Zinc finger protein 451

Protein name: zinc finger protein 451

Full length: 1061 amino acids

Entry name: ZN451_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-10471-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10471-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 26036