Recombinant Human ZNF461 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAF7

Gene Name: ZNF461

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 30%

Start Site: Asp91

End Site: Gln240

Coverage: 0.29

Isoelectric Point: 6.5

Core Sequence: DNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 30%, Pig - 62%, Cynomolgus monkey - 95%

Alternative gene names: GIOT1

Alternative protein names: Zinc finger protein 461; Gonadotropin-inducible ovary transcription repressor 1; GIOT-1

Protein name: zinc finger protein 461

Full length: 563 amino acids

Entry name: ZN461_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3399-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3399-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 92283