Recombinant Human ZNF559 Protein

Recombinant Human ZNF559 Protein
SKU
ASBPP-3478-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BR84

Gene Name: ZNF559

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Gly331

End Site: Met400

Coverage: 0.16

Isoelectric Point: 9

Core Sequence: GKAFTDSSGLIKHRRTHTGEKPYECKECGKAFANSSHLTVHMRTHTGEKPYQCKECGKAFINSSSFKSHM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 69%, Pig - 69%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 559

Protein name: zinc finger protein 559

Full length: 538 amino acids

Entry name: ZN559_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3478-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3478-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 84527
Product information (PDF)
×
MSDS (PDF)
×