Recombinant Human ZNF575 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86XF7

Gene Name: ZNF575

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Glu21

End Site: Phe100

Coverage: 0.37

Isoelectric Point: 10.5

Core Sequence: EPVTKEAPHQGPPQKPSQSAPGPTASAGSPPRPRRRPPPQRPHRCPDCDKAFSYPSKLATHRLAHGGARPHPCPDCPKAF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 34%, Pig - 91%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 575

Protein name: zinc finger protein 575

Full length: 245 amino acids

Entry name: ZN575_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3396-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3396-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 284346