Recombinant Human ZNF582 Protein

Recombinant Human ZNF582 Protein
SKU
ASBPP-10380-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96NG8

Gene Name: ZNF582

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Gln381

End Site: Gln470

Coverage: 0.19

Isoelectric Point: 9.5

Core Sequence: QLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYRIHTGEKPYECKECGKAFSHCSQLIHHQVIHTEKKPYEYKECEKTLSHDSTTVQPQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 59%, Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 582

Protein name: zinc finger protein 582

Full length: 517 amino acids

Entry name: ZN582_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10380-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10380-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 147948
Product information (PDF)
×
MSDS (PDF)
×