Recombinant Human ZNF606 Protein

Recombinant Human ZNF606 Protein
SKU
ASBPP-3648-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8WXB4

Gene Name: ZNF606

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Glu41

End Site: Trp170

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: EGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEPWSVEQACPQRTCPEWVRNLESKALIPAQSIFEEEQSHGMKLERYIWDDPW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 53%, Pig - 82%, Cynomolgus monkey - 98%

Alternative gene names: KIAA1852; ZNF328

Alternative protein names: Zinc finger protein 606; Zinc finger protein 328

Protein name: zinc finger protein 606

Full length: 792 amino acids

Entry name: ZN606_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3648-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3648-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 80095
Product information (PDF)
×
MSDS (PDF)
×