Recombinant Human ZNF623 Protein

Recombinant Human ZNF623 Protein
SKU
ASBPP-3606-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75123

Gene Name: ZNF623

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Asn11

End Site: Gln170

Coverage: 0.30

Isoelectric Point: 6.5

Core Sequence: NVGTGEKKVTEAWISEDENSHRTTSDRLTVMELPSPESEEVHEPRLGELLGNPEGQSLGSSPSQDRGCKQVTVTHWKIQTGETAQVCTKSGRNHILNSDLLLLQRELIEGEANPCDICGKTFTFNSDLVRHRISHAGEKPYTCDQCGKGFGQSSHLMEHQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 47%, Pig - 49%, Cynomolgus monkey - 95%

Alternative gene names: KIAA0628

Alternative protein names: Zinc finger protein 623

Protein name: zinc finger protein 623

Full length: 536 amino acids

Entry name: ZN623_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3606-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3606-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9831
Product information (PDF)
×
MSDS (PDF)
×