Recombinant Human ZNF670 Protein

Recombinant Human ZNF670 Protein
SKU
ASBPP-3442-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BS34

Gene Name: ZNF670

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Val11

End Site: Leu140

Coverage: 0.37

Isoelectric Point: 6.5

Core Sequence: VAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPCECSVCGKVFICHSALHRHILSHIGNKLFECEECPEKL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Rat - 31%, Pig - 63%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 670

Protein name: zinc finger protein 670

Full length: 389 amino acids

Entry name: ZN670_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3442-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3442-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 93474
Product information (PDF)
×
MSDS (PDF)
×