Recombinant Human ZNF683 Protein

Recombinant Human ZNF683 Protein
SKU
ASBPP-3511-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8IZ20

Gene Name: ZNF683

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 41%

Start Site: Pro111

End Site: Ser180

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: PGLQASSTDDKKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 41%, Pig - 63%, Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Tissue-resident T-cell transcription regulator protein ZNF683; Homolog of Blimp-1 in T-cell; Hobit; Zinc finger protein 683

Protein name: zinc finger protein 683

Full length: 524 amino acids

Entry name: ZN683_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3511-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3511-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 257101
Product information (PDF)
×
MSDS (PDF)
×