Recombinant Human ZNF700 Protein

Recombinant Human ZNF700 Protein
SKU
ASBPP-383-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0M5

Gene Name: ZNF700

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 40%

Start Site: Glu11

End Site: Gly190

Coverage: 0.26

Isoelectric Point: 6.5

Core Sequence: EDPGTSESREMDPVAFEDVAVNFTQEEWTLLDISQKNLFREVMLETFRNLTSIGKKWSDQNIEYEYQNPRRSFRSLIEEKVNEIKEDSHCGETFTQVPDDRLNFQEKKASPEVKSCDSFVCAEVGIGNSSFNMSIRGDTGHKAYEYQEYGPKPYKCQQPKNKKAFRYRPSIRTQERDHTG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 40%, Rat - 55%, Pig - 54%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 700

Protein name: zinc finger protein 700

Full length: 742 amino acids

Entry name: ZN700_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-383-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-383-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 90592
Product information (PDF)
×
MSDS (PDF)
×