Recombinant Human ZNF749 Protein

Recombinant Human ZNF749 Protein
SKU
ASBPP-3585-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43361

Gene Name: ZNF749

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 34%

Start Site: Glu11

End Site: Gly220

Coverage: 0.28

Isoelectric Point: 6

Core Sequence: EDVAIYFSQEEWGILNDAQRHLHSNVMLENFALLSSVGCWHGAKDEEVPSKQCVSVRVLQVTIPKPALSTLKAQPCKMCSSILKDILHLAEHDGTHPEQGLYTCAAEHDLHQKEQIREKLTRSDEWRPSFVNHSAHVGERNFTCTQGGKDFTASSDLLQQQVLNSGWKLYRDTQDGEAFQGEQNDFNSSQGGKDFCHQHGLFEHQKTHNG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 34%, Rat - 36%, Pig - 46%, Cynomolgus monkey - 90%

Alternative gene names: /

Alternative protein names: Zinc finger protein 749

Protein name: zinc finger protein 749

Full length: 778 amino acids

Entry name: ZN749_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3585-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3585-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 388567
Product information (PDF)
×
MSDS (PDF)
×