Recombinant Human ZNF787 Protein

Recombinant Human ZNF787 Protein
SKU
ASBPP-3503-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6DD87

Gene Name: ZNF787

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Gln111

End Site: Ala220

Coverage: 0.29

Isoelectric Point: 11

Core Sequence: QHRRIHTGEKPYACLECGKRFSWSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCGRGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 54%, Pig - 98%, Cynomolgus monkey - 61%

Alternative gene names: /

Alternative protein names: Zinc finger protein 787; TTF-I-interacting peptide 20

Protein name: zinc finger protein 787

Full length: 382 amino acids

Entry name: ZN787_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3503-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3503-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 126208
Product information (PDF)
×
MSDS (PDF)
×