Recombinant Human ZNF81 Protein

Recombinant Human ZNF81 Protein
SKU
ASBPP-10480-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51508

Gene Name: ZNF81

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Val21

End Site: Thr120

Coverage: 0.17

Isoelectric Point: 5

Core Sequence: VSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 61%, Pig - 82%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 81; HFZ20

Protein name: zinc finger protein 81

Full length: 661 amino acids

Entry name: ZNF81_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10480-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10480-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 347344
Product information (PDF)
×
MSDS (PDF)
×