Recombinant Human ZNF816 Protein

Recombinant Human ZNF816 Protein
SKU
ASBPP-3546-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q0VGE8

Gene Name: ZNF816

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Val541

End Site: Phe630

Coverage: 0.15

Isoelectric Point: 9.5

Core Sequence: VCDKAFRSDSCLANHTRVHTGEKPYKCNKCAKVFNQKGILAQHQRVHTGEKPYKCNECGKVFNQKASLAKHQRVHTAEKPYKCNECGKAF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 61%, Pig - 71%, Cynomolgus monkey - 76%

Alternative gene names: ZNF816A

Alternative protein names: Zinc finger protein 816

Protein name: zinc finger protein 816

Full length: 651 amino acids

Entry name: ZN816_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3546-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3546-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 125893
Product information (PDF)
×
MSDS (PDF)
×