Recombinant Human ZNF836 Protein

Recombinant Human ZNF836 Protein
SKU
ASBPP-3562-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZNA1

Gene Name: ZNF836

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Arg11

End Site: Lys210

Coverage: 0.22

Isoelectric Point: 6

Core Sequence: RDVAIEFSQEEWKSLDPVQKALYWDVMLENYRNLVFLGILPKCMTKELPPIGNSNTGEKCQTVTLERHECYDVENFYLREIQKNLQDLEFQWKDGEINYKEVPMTYKNNLNGKRGQHSQEDVENKCIENQLTLSFQSRLTELQKFQTEGKIYECNQSEKTVNNSSLVSPLQRILPSVQTNISKKYENEFLQLSLPTQLEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 55%, Pig - 42%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 836

Protein name: zinc finger protein 836

Full length: 936 amino acids

Entry name: ZN836_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3562-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3562-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 162962
Product information (PDF)
×
MSDS (PDF)
×