Recombinant Human ZNF85 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q03923

Gene Name: ZNF85

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Leu441

End Site: Lys530

Coverage: 0.17

Isoelectric Point: 9.5

Core Sequence: LTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKGFKWPSTLTIHKIIHTGEKPYKCEECGKAFNQSSKLTKHKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 65%, Pig - 63%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 85; Zinc finger protein HPF4; Zinc finger protein HTF1

Protein name: zinc finger protein 85

Full length: 595 amino acids

Entry name: ZNF85_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10493-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10493-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7639