Recombinant Human ZNF876P Protein

Recombinant Human ZNF876P Protein
SKU
ASBPP-3506-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q49A33

Gene Name: ZNF876P

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: His81

End Site: Lys150

Coverage: 0.39

Isoelectric Point: 9.5

Core Sequence: HKNIHTGEKSYKCEECGNAFYRSSHLTKHKRIHSGQKPYKCEECGKAFRQSSALNEHKKIHTAEKPYKCK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 61%, Pig - 68%, Cynomolgus monkey - 81%

Alternative gene names: /

Alternative protein names: Putative zinc finger protein 876

Protein name: zinc finger protein 876, pseudogene

Full length: 203 amino acids

Entry name: Z876P_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3506-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3506-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 642280
Product information (PDF)
×
MSDS (PDF)
×