Recombinant Human ZSCAN10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96SZ4

Gene Name: ZSCAN10

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Asp91

End Site: Met340

Coverage: 0.35

Isoelectric Point: 5.5

Core Sequence: DVTLEEKGCASQVPSHSPKKELPAEEPSVLGPSDEPPRPQPRAAQPAEPGQWRLPPSSKQPLSPGPQKTFQALQESSPQGPSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQADSPGVPGEPCAQSLGRGAAASGPGEDGSLLGSSEILEVKVAEGVPEPNPELQFICADCGVSFPQLSRLKAHQLRSHPAGRSFLCLCCGKSFGRSSILKLHM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 47%, Pig - 67%, Cynomolgus monkey - 94%

Alternative gene names: ZNF206

Alternative protein names: Zinc finger and SCAN domain-containing protein 10; Zinc finger protein 206

Protein name: zinc finger and SCAN domain containing 10

Full length: 725 amino acids

Entry name: ZSC10_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3517-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3517-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 84891