Recombinant Human ZSCAN10 Protein

Recombinant Human ZSCAN10 Protein
SKU
ASBPP-3517-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96SZ4

Gene Name: ZSCAN10

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Asp91

End Site: Met340

Coverage: 0.35

Isoelectric Point: 5.5

Core Sequence: DVTLEEKGCASQVPSHSPKKELPAEEPSVLGPSDEPPRPQPRAAQPAEPGQWRLPPSSKQPLSPGPQKTFQALQESSPQGPSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQADSPGVPGEPCAQSLGRGAAASGPGEDGSLLGSSEILEVKVAEGVPEPNPELQFICADCGVSFPQLSRLKAHQLRSHPAGRSFLCLCCGKSFGRSSILKLHM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 47%, Pig - 67%, Cynomolgus monkey - 94%

Alternative gene names: ZNF206

Alternative protein names: Zinc finger and SCAN domain-containing protein 10; Zinc finger protein 206

Protein name: zinc finger and SCAN domain containing 10

Full length: 725 amino acids

Entry name: ZSC10_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3517-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3517-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 84891
Product information (PDF)
×
MSDS (PDF)
×