Rfc1 Antibody - C-terminal region : FITC

Rfc1 Antibody - C-terminal region : FITC
SKU
AVIARP56521_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rfc1 is a transcriptional repressor that regulates transcription of the vasoactive intestinal peptide receptor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rfc1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Replication factor C subunit 1

Protein Size: 656

Purification: Affinity Purified
More Information
SKU AVIARP56521_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56521_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 89809
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×